DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and crispl

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001025526.1 Gene:crispl / 594930 XenbaseID:XB-GENE-5768874 Length:314 Species:Xenopus tropicalis


Alignment Length:239 Identity:51/239 - (21%)
Similarity:79/239 - (33%) Gaps:86/239 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
            |::.|||.|.      :.||..:.|..:.|....||.|......|:          .|...:...
 Frog   111 ILNVHNELRR------NANPPPSNMLKMVWSDLAAKSAAKWANSCK----------QYHSLKPER 159

  Fly   129 SLEKYFC-----MTTKKEALRKQLDHWFDPNSKDEVQKLFFS------WTKNQQELS---KNYFQ 179
            ::..:.|     |.:.|.:       |      ::|.:.|:|      :.|..:|:.   .::.|
 Frog   160 TIPGFSCGENLFMASYKAS-------W------EDVIRAFYSEIEDFLYGKGAKEVGLQILHFTQ 211

  Fly   180 VLRDRANRVGCAIVEYVRPALVHQL---LKCVY-------NCGVSL-----CEEEDNPVYEDTDE 229
            |:...:..||||..:.  |...|.|   ..|.|       |.|:..     ||          |.
 Frog   212 VMWFSSWLVGCAAAQC--PITDHSLEFYFVCHYAPAGNYGNVGIPYKTGKPCE----------DC 264

  Fly   230 EAASE---CMKGSNKQYK--------NLCHKDELVK-----TCN 257
            :::.|   |..|.|.|.|        ..|..|...|     |||
 Frog   265 KSSCENGLCTNGCNFQNKFSNCDTPDTHCDTDPTAKNDCPATCN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 34/169 (20%)
crisplNP_001025526.1 CAP_CRISP 106..245 CDD:349402 34/164 (21%)
Crisp 261..314 CDD:369954 15/58 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.