DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and pi15a

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001153449.1 Gene:pi15a / 561978 ZFINID:ZDB-GENE-040724-135 Length:260 Species:Danio rerio


Alignment Length:146 Identity:36/146 - (24%)
Similarity:61/146 - (41%) Gaps:35/146 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH 123
            ||:| |:|.||:.|.|..      |.|:.|..:.||..|||.|           :|.|.|..:.|
Zfish    68 DMLA-ILDYHNKVRGKVF------PPASNMEYMVWDDTLAKTA-----------EQWASTCIWEH 114

  Fly   124 AE---VSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKN---------QQELSKN 176
            ..   :.:..:.....|.:..::.:.:..|     .|||:...|.:.::         ...:..:
Zfish   115 GPRNLLRFLGQNLSVRTGRYRSILQLVKPW-----HDEVKDYSFPYPRDCNPRCPLKCYGPMCTH 174

  Fly   177 YFQVLRDRANRVGCAI 192
            |.|::...:|:|||||
Zfish   175 YTQMVWATSNKVGCAI 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 34/144 (24%)
pi15aNP_001153449.1 SCP_euk 71..214 CDD:240180 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585803
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.