DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and pi15b

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_684600.2 Gene:pi15b / 556658 ZFINID:ZDB-GENE-070912-590 Length:257 Species:Danio rerio


Alignment Length:171 Identity:46/171 - (26%)
Similarity:67/171 - (39%) Gaps:39/171 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYR-NKFAGGMDQNPKAARMTTIEWDPELA 98
            |.||.|  ..:.||..........|||| |:|.||:.| |.|       |.||.|..:.||    
Zfish    43 LGDDQG--IGSKPKSRRKRYISQSDMIA-ILDYHNKVRANVF-------PPAANMEYMLWD---- 93

  Fly    99 KVADGLVRRCEPIRDQCAITPNYGHAE---VSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQ 160
               |||.|..|.....|.    :.|..   :.|..:.....|....::.:.:..|:     |||:
Zfish    94 ---DGLARSAEAWAATCI----WEHGPPYLLRYLGQNLSVRTGNYRSILQLVKPWY-----DEVR 146

  Fly   161 KLFFSWTKN---------QQELSKNYFQVLRDRANRVGCAI 192
            ...|.:.::         ...:..:|.|::...:|||||||
Zfish   147 DYMFPYPRDCNPHCPMRCYGPMCTHYTQMVWASSNRVGCAI 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 38/145 (26%)
pi15bXP_684600.2 SCP_euk 68..211 CDD:240180 37/144 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585782
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.