DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Glipr1l3

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001360960.1 Gene:Glipr1l3 / 544736 MGIID:3620621 Length:236 Species:Mus musculus


Alignment Length:195 Identity:46/195 - (23%)
Similarity:80/195 - (41%) Gaps:49/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSL-- 130
            |||.|.|.      .|.||.|..:.||.:|||:|....|.|:...:.|. :..|| ..:.|..  
Mouse    49 HNELRRKV------QPPAADMNQVIWDQKLAKLAKAWTRECKLGHNPCT-SKQYG-CLLDYDFIG 105

  Fly   131 EKYFC--MTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQ-QELSKNYFQVLRDRANRVGCAI 192
            |..:.  :.|:.|.:   :::|::.|:.       :::..|. .::.:||.|::..:..::|||:
Mouse   106 ENIYLGEIETQPEDV---VNNWYNENTD-------YNFVDNTCSKICRNYTQLVWAKTFKIGCAV 160

  Fly   193 VEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDE----------EAASECMKGSNKQYKNLC 247
            ...  |.|..      |:.|:.:|.      |..|..          :..|.|  |..|...:||
Mouse   161 SNC--PNLTR------YSAGLFVCN------YSPTGNFLDFRPYRKGDPCSMC--GQRKCENSLC 209

  Fly   248  247
            Mouse   210  209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 35/146 (24%)
Glipr1l3NP_001360960.1 CAP 40..182 CDD:381818 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.