DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:222 Identity:49/222 - (22%)
Similarity:77/222 - (34%) Gaps:73/222 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYS 129
            ::.|||.|.|.      .|.|:.|..:.||..|||:|....|.|:...:.|              
  Rat    46 LNSHNEARRKV------QPPASNMNQLSWDKSLAKLAKSWTRECKFSHNPC-------------- 90

  Fly   130 LEKYFCMTTKKEALRKQLDH--------WFDPNSKDEVQKLFFSWTKNQQELS----------KN 176
                   |:|:....|..|:        ..|...:|.|    |||....::.:          .:
  Rat    91 -------TSKRHGCTKDYDYIGENIYLGKIDARPEDVV----FSWYNETKDYNFDDNTCTKTCGH 144

  Fly   177 YFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCE-------EEDNPVYEDTDEEAASE 234
            |.||:..:..::||||...  |.|..      |:.|:.:|.       :...|..:.   |..|.
  Rat   145 YTQVVWAKTLKIGCAISNC--PHLTG------YSAGLFVCNYVPAGNFQGSKPYIKG---EPCSM 198

  Fly   235 CMKGSNKQYKNLCH----KDELVKTCN 257
            |  |..:...:||.    :....|||:
  Rat   199 C--GEKECVNSLCSHTMGRASQQKTCH 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 36/162 (22%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 39/173 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344787
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.