DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CLEC18B

DIOPT Version :10

Sequence 1:NP_610029.2 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_047302585.1 Gene:CLEC18B / 497190 HGNCID:33849 Length:481 Species:Homo sapiens


Alignment Length:66 Identity:17/66 - (25%)
Similarity:26/66 - (39%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 ESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRR 107
            :...|...|...|.|:    |::..||..|:..      .|.||.|..::|...||::|......
Human    34 QEQAPMAGALNRKESF----LLLSLHNRLRSWV------QPPAADMRRLDWSDSLAQLAQARAAL 88

  Fly   108 C 108
            |
Human    89 C 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_610029.2 CAP_euk 61..210 CDD:349399 13/48 (27%)
CLEC18BXP_047302585.1 CAP_euk 50..188 CDD:349399 13/46 (28%)
EGF_CA 235..266 CDD:238011
CLECT 315..439 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.