DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG11977

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:205 Identity:47/205 - (22%)
Similarity:84/205 - (40%) Gaps:39/205 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WCKADLC--RGQHVLCDDNGNFEST-CPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPK 84
            :|.||:|  ..:|:.|  ...|.|| |.:.... |:|| |....||...|.:|.|...|:...|:
  Fly    44 YCNADICPANKKHITC--GFKFWSTKCGRNHEG-VRMS-DYRYDIVRNVNNFRRKLEWGLGNLPR 104

  Fly    85 AARMTTIEWDPELAKVADGLVRRC-EPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLD 148
            |.:...|:||.||:.:|..:..:| :.....|..|..|.....|....| ...|:|...:...|:
  Fly   105 AVKFKNIKWDDELSVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVK-VQNTSKGFNVISFLN 168

  Fly   149 HWFD-------------PNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPAL 200
            .||:             ||...:.:.:.|:             .::.::..::||.:|:..:   
  Fly   169 MWFEYHKMMKPSYVNNFPNIAPQDRLIIFA-------------NLIYEKNKKMGCGMVKSGQ--- 217

  Fly   201 VHQLLKCVYN 210
             .:.|.|:::
  Fly   218 -GRFLTCLFD 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 33/162 (20%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 33/162 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.