DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG42564

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:244 Identity:68/244 - (27%)
Similarity:109/244 - (44%) Gaps:30/244 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WCKADLCRGQ--HVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFA-GGMDQNPK 84
            :|...||..:  ||.|:.:......|...|..:| :|..:...::.:.||.|:..| ||.:....
  Fly    55 YCDPSLCHKELKHVACNASIELHDKCSLDAELIV-ISPKVERFLLRRFNELRDSVAKGGFNGLSP 118

  Fly    85 AARMTTIEWDPELAKVADGLVRRCEPIRDQC---AITPNYGHAEVSY--------SLEKYFCMTT 138
            |:||.|::|:||||.:|:..||.|....|:|   ..|.|.|.. |.|        .||       
  Fly   119 ASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQT-VGYRGIKGKLPELE------- 175

  Fly   139 KKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQ 203
              :.||..:..|....|:..:..:.....:..|....|:.|::.:.|..||||||:..|    |.
  Fly   176 --DILRDIIGVWLREKSRTSMVNIMKYVEQESQSPKYNFLQIVLENAESVGCAIVQQSR----HG 234

  Fly   204 LLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDEL 252
            .::..:.|.........:|||| ..::||..|..|:|.:|.:||.:.|:
  Fly   235 WIQTFFACNYGHAPVVGSPVYE-PGKKAAESCKTGANPKYAHLCAESEV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 44/160 (28%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 45/163 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440637
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.