DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG6628

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648386.1 Gene:CG6628 / 39183 FlyBaseID:FBgn0036072 Length:277 Species:Drosophila melanogaster


Alignment Length:263 Identity:73/263 - (27%)
Similarity:124/263 - (47%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFSTLYI---QD--TGASDKWCKADLCRG--QHVLCDDNGNFESTCPKQAAAMVKMSWDMIALI 64
            :||..|.:   ||  |.....:|::.||..  :|:.|.:.|.....|... |.:|.:: .:..||
  Fly    10 MLFGFLQVAFSQDNATAPPTDYCQSGLCPSLKKHIACKNKGELGKQCSPD-AHLVNLT-GLQDLI 72

  Fly    65 VDKHNEYRNKFAGGMDQN-PKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
            :.:||..||..|.|...| ||..||.|::|..|||.:|...|::|....|.|..||::.::..:.
  Fly    73 LGEHNALRNVLASGKIINLPKPDRMATLQWHSELADLATLNVKQCVLQHDSCHNTPDFHNSGQNL 137

  Fly   129 SLEKYFCMT-----TKKEALRKQLDHWFDPN---SKDEVQKLFFSWTKNQQELSKNYFQVLRDRA 185
            :|.....:.     |.:..:::.:..|::.:   :|:::|:  |...|....: :|:..:.||..
  Fly   138 ALVNITLLPEDGNHTDECLVKESIGGWWNQSINITKEQLQR--FPKGKLGDSI-RNFAVMARDNN 199

  Fly   186 NRVGCAIVEYVRPALVHQ--LLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCH 248
            ..||||.:.:.:|| .|.  ||.|.|....    ..|.|:|    :|.|..|..||:.:|.:||.
  Fly   200 THVGCAALRFEKPA-GHPLFLLACNYASNY----VPDWPIY----KEKAIGCQSGSDLKYPSLCK 255

  Fly   249 KDE 251
            ..|
  Fly   256 AGE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 45/159 (28%)
CG6628NP_648386.1 SCP_euk 69..225 CDD:240180 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440700
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.