DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG8072

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_648384.1 Gene:CG8072 / 39181 FlyBaseID:FBgn0036070 Length:247 Species:Drosophila melanogaster


Alignment Length:251 Identity:64/251 - (25%)
Similarity:116/251 - (46%) Gaps:31/251 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFSTLYIQDTGASDKWCKADLCRG-QHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEY 71
            |...|:::...|.| :|....|.| :|:.||:|..|:.:| .:...:|.|:: ....::..||.|
  Fly    10 LCKILFLRSILAID-FCDIKSCHGKRHIGCDNNMMFDESC-LRFHGLVNMAY-FREYLLGLHNGY 71

  Fly    72 RNKFAGGMDQN-PKAARMTTIEWDPELAKVADGLVRRCE---PIRDQCAITPNYGHAEVSYSLEK 132
            |.:.|..:..: |.|.:|..:.||..|:.||:..::||:   | .|.|..|.::.....:|:.:.
  Fly    72 RQEVASNLFVDLPPAQKMPELVWDNYLSVVAEYHLKRCQMDLP-DDSCVATDDFSEPHFNYAEDF 135

  Fly   133 YFCMTTKKEALRKQ---LDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVE 194
            |.....::..:|:.   .:.|.     ||:..|....|.:.:...:|   ::.||::.:|||..:
  Fly   136 YPRPVIRQSNVREMTILAEQWL-----DELYDLDDIATYSAEGEIRN---IINDRSSYMGCAAGQ 192

  Fly   195 YVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEA---ASECMKGSNKQYKNLC 247
            ......:|.:|.|.|:.|        .||..:..||.   |:.|..|.:.:|.|||
  Fly   193 DYDLWNIHFVLVCYYSSG--------PPVEGNLYEEGIFNATLCPNGQSDEYPNLC 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 36/155 (23%)
CG8072NP_648384.1 SCP_euk 61..208 CDD:240180 36/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.