DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG43775

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_726425.3 Gene:CG43775 / 37863 FlyBaseID:FBgn0264297 Length:272 Species:Drosophila melanogaster


Alignment Length:287 Identity:59/287 - (20%)
Similarity:97/287 - (33%) Gaps:106/287 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DLCRGQHVLC--------DDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGG-MD-- 80
            ||.:.:|.:|        .....:.::.|.    .:|:..|.:|::    |.:|:..||| :|  
  Fly    32 DLAQRKHFMCRLGELKPYGGRAKYYASIPD----TLKVRKDTLAVL----NTFRDMLAGGELDTA 88

  Fly    81 QN---PKAARMTTIEWDPELAKVADGLVRRCEPIRDQC-------------AITPNYGHAEVSYS 129
            :|   |.|.||..::||.|||.:|.........:..:|             |::|..||      
  Fly    89 ENKTFPSAKRMRALQWDSELAYMARTHAATVSFMHSECRSTLRFPLAGEVLALSPPVGH------ 147

  Fly   130 LEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVL-RDRANRVGCAIV 193
                  ..:..|.||....|.||.....:..:.|.....::::.|..:|.:: .||.:||||...
  Fly   148 ------RLSLTELLRMVFAHIFDEYKTVQDPQSFARRFDSKRDYSVGHFSIIVNDRVSRVGCGFA 206

  Fly   194 EYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNG 258
                                                       .|||      |.||..|..|: 
  Fly   207 -------------------------------------------VGSN------CEKDGKVGFCH- 221

  Fly   259 GSLFVEPENDYNDGQEENMENDYEFET 285
               |:....||.     |:...|.::|
  Fly   222 ---FLTCHFDYT-----NVNGSYVYKT 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 38/168 (23%)
CG43775NP_726425.3 SCP_euk 66..228 CDD:240180 48/230 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440516
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.