DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG9822

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:104/253 - (41%) Gaps:56/253 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 WCKADLCRGQ--HVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFA-GGMDQNPK 84
            ||..|||...  |:.|:::|.|..:|... |.||.:. ....|||::||:.||..| |.:.....
  Fly    26 WCDPDLCPDNTVHIACNNDGKFHESCSPD-ATMVDLK-PYRKLIVNEHNKRRNYIASGSLPGYYP 88

  Fly    85 AARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY-SLEKYFCMTTKK-------- 140
            |.||.|:.||.||..:|...::.|....|.|       |....: :|.:..|...::        
  Fly    89 ATRMATMVWDEELEYLATLNLKTCYLEHDDC-------HNSYRFRNLGQNLCGVDRRRNWDLNVT 146

  Fly   141 EALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSK--NYFQVLRDRANRVGCAIVEYVRP----- 198
            ..:.:.:..||..:..  :...:.:..|..::|.|  ::.:.:.||...||||::.:..|     
  Fly   147 NLVEQSMGLWFGEHKL--IDSSYITDFKLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNPQYPFL 209

  Fly   199 ---------ALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLC 247
                     |.|:.:...|||.|                 :.||||..|||.:|..||
  Fly   210 YIYNTACNYASVYAIGVPVYNAG-----------------KPASECRTGSNPEYPALC 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 39/174 (22%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 36/163 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.900

Return to query results.
Submit another query.