DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:206 Identity:40/206 - (19%)
Similarity:76/206 - (36%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRC--------EPIRDQC 115
            |.|...|:.|||.|....      |....:..:.||..|::.|....::|        :.:.:..
  Rat    51 DFINEYVNLHNELRGTVF------PPGVNLRFMTWDVALSRTARAWGKKCVFERNTHLDKVHESH 109

  Fly   116 AITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKN---QQELSKNY 177
            .:..:.|. .:....||.|   |...|:|.    |.:       ::..:::..:   :.|...:|
  Rat   110 PVFTDIGE-NMWVGPEKDF---TATNAIRS----WHE-------ERKSYNYVNDTCIEDEDCSHY 159

  Fly   178 FQVLRDRANRVGCAIVEYVRPALV--HQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSN 240
            .|::.|.:.:||||:....:...:  ..|..|.|..|.:|...         ..:|...|.:.:|
  Rat   160 IQLVWDHSYKVGCAVTPCAKVGAITYAALFICNYAPGGTLTRR---------PYQAGQFCSRCTN 215

  Fly   241 KQ--YKNLCHK 249
            ::  ...||.|
  Rat   216 EEKCIDFLCGK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 30/161 (19%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 32/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344808
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.