DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crisp2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:197 Identity:37/197 - (18%)
Similarity:70/197 - (35%) Gaps:27/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
            |:.||||.|.:.      :|..:.:..:||:.:.|..|......|  |.:..:....    :::.
  Rat    41 IIAKHNELRRQV------SPPGSNILKMEWNVQAAANAQKWANNC--ILEHSSTEDR----KINI 93

  Fly   129 SLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIV 193
            ...:...|:|...:.|..:..|::.|     :...|...........:|.|::...:.:|||.:.
  Rat    94 KCGENLYMSTDPTSWRTVIQSWYEEN-----ENFVFGVGAKPNSAVGHYTQLVWYSSFKVGCGVA 153

  Fly   194 EYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHK----DELVK 254
            ....    ...||..|.|  ..|...:|.:.:.|.....:.|....|.....||..    ::|:.
  Rat   154 YCPN----QDTLKYFYVC--HYCPMGNNVMKKSTPYHQGTPCASCPNNCDNGLCTNSCDFEDLLS 212

  Fly   255 TC 256
            .|
  Rat   213 NC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 26/145 (18%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 29/153 (19%)
Crisp 189..243 CDD:400739 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344766
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.