DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG4270

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_608663.1 Gene:CG4270 / 33408 FlyBaseID:FBgn0031407 Length:170 Species:Drosophila melanogaster


Alignment Length:142 Identity:30/142 - (21%)
Similarity:48/142 - (33%) Gaps:59/142 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RGQHVLCDDNGN--------FEST--------CPKQA--AAMVKMSWDMIALIVDKHN------- 69
            |||    |..||        |.:|        ||...  ||:.|::.:....:.|::.       
  Fly    20 RGQ----DTKGNNELFLKEVFNTTNKYRAMHGCPAVTINAALNKLAQEWANHLRDQNTMAHRPNP 80

  Fly    70 EY-RNKF-AGGMDQN-----------------------PKAARMTTIEWDPELAKVADGLVRRCE 109
            :| .|.| :||||..                       |.|...|.:.|...: ::..|:.|:. 
  Fly    81 KYGENIFLSGGMDVTGDLPVEMWYREINSYDFNKAQFVPTAGHFTQLIWKSSV-EMGSGVARKA- 143

  Fly   110 PIRDQCAITPNY 121
               |:..:..||
  Fly   144 ---DRTWVVCNY 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 17/93 (18%)
CG4270NP_608663.1 SCP_GAPR-1_like 31..158 CDD:240182 24/127 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455146
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.