DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and glipr2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:191 Identity:36/191 - (18%)
Similarity:61/191 - (31%) Gaps:66/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 HAEVSYSLEKYFCMTTKKEA----LRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKN-----YF 178
            |.....:..|..|.:.::.|    ..|.|.|    ::|...:.|:::|:...::|:.|     ::
Zfish    21 HGAPPLTFNKNLCRSAQQWAEHLLSTKTLAH----SNKGYGENLYYAWSSANKKLTGNEAVDSWY 81

  Fly   179 QVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQY 243
            ..::|         ..:.||..            .|........|::||.|....          
Zfish    82 GEIKD---------YNFSRPGF------------SSKTGHFTQVVWKDTKELGVG---------- 115

  Fly   244 KNLCHKDELVKTCNGGSLFVEPENDYNDGQ---EENMENDYEFETTVFTLPTYDPNDVLPT 301
                      ...:|.::||.       ||   ..|:.|...||..|  |||....|..||
Zfish   116 ----------LATDGNTIFVV-------GQYLPAGNIANAGYFEKNV--LPTGSKLDQKPT 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 15/95 (16%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 25/165 (15%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.