DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crispld1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:264 Identity:54/264 - (20%)
Similarity:89/264 - (33%) Gaps:99/264 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKA 85
            |:|..|.. ||:..:.|:                    ||.: |:|.||:.|::.      .|.|
  Rat    44 DEWWTAKQ-RGKRAITDN--------------------DMQS-ILDLHNKLRSQV------YPAA 80

  Fly    86 ARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHW 150
            :.|..:.||.||.:.|:.....|.......::.|:.|. .:.....:|...|...:|       |
  Rat    81 SNMEYMTWDVELERSAESWAETCLWEHGPTSLLPSIGQ-NLGAHWGRYRPPTFHVQA-------W 137

  Fly   151 FDPNSKDEVQKLFFSWTKNQQ-----------ELSKNYFQVLRDRANRVGCAIVEYVRPALVHQL 204
            :     |||:.  ||:....:           .:..:|.||:...::|:||||      .|.|.:
  Rat   138 Y-----DEVRD--FSYPYEHECDPYCPFRCSGPVCTHYTQVVWATSSRIGCAI------NLCHNM 189

  Fly   205 ------------LKCVYN---------------------------CGVSLCEEEDNPVYEDTDEE 230
                        |.|.|:                           |..:||.:|.:..|....||
  Rat   190 NIWGQIWPKAVYLVCNYSPKGNWWGHAPYKHGKPCSACPPSFGGGCRENLCYKEGSDQYYTPQEE 254

  Fly   231 AASE 234
            ..:|
  Rat   255 ETNE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/171 (22%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 37/171 (22%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344640
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.