DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Glipr1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:222 Identity:54/222 - (24%)
Similarity:82/222 - (36%) Gaps:67/222 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 STCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRC 108
            ||.||..      :.|.|...|:.||.:|:|      ..|.|..|..:.|||:||::|....:.|
  Rat    23 STLPKIT------NEDFIEECVEVHNHFRSK------AYPPAGNMLYMSWDPKLAQIAKAWAQSC 75

  Fly   109 ----EPIRDQCAITPNY-GHAEVSY--SLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSW 166
                .| :....|.||: |..|..:  ||..:        ::|..:..||     :|.|...|| 
  Rat    76 VFQHNP-QLHSRIHPNFTGLGENIWLGSLSLF--------SVRAAILAWF-----EESQYYDFS- 125

  Fly   167 TKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDN---------- 221
            |...:::..:|.|::...:.::|||                     |.||....|          
  Rat   126 TGKCKKVCGHYTQIVWADSYKIGCA---------------------VQLCPRGANFICNYGPAGN 169

  Fly   222 -PVYEDTDEEAASECMKGSNKQYKNLC 247
             |.:........|.|.| .:|...|||
  Rat   170 YPTWPYKQGATCSACPK-DDKCLNNLC 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/155 (24%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 42/177 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344724
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.