DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:188 Identity:47/188 - (25%)
Similarity:72/188 - (38%) Gaps:25/188 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYS 129
            ::.|||:|.|.      ||.||.|..:.||..|||:|.....:|:...:.|.......:|...|.
Human   123 IEAHNEWRGKV------NPPAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYV 181

  Fly   130 LEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVE 194
            .|..:....|....|..:..|::.....:...|..|      .:..:|.|::...:..||||:  
Human   182 GENIWLGGIKSFTPRHAITAWYNETQFYDFDSLSCS------RVCGHYTQLVWANSFYVGCAV-- 238

  Fly   195 YVRPALVHQL---LKCVYNCGVSLCEEEDN-PVYEDTDEEAASECMKGSNKQYKNLCH 248
                |:...|   ...::.|.........| |.|  ...|:.|.|.| ..|..||||:
Human   239 ----AMCPNLGGASTAIFVCNYGPAGNFANMPPY--VRGESCSLCSK-EEKCVKNLCN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 34/147 (23%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151313
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.