DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG30486

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:281 Identity:78/281 - (27%)
Similarity:124/281 - (44%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MIKCIWLLFSTLYIQDTGASDKWCKADLCRGQ--HVLCDDNGNFESTCPKQAAAMVKMSWDMIAL 63
            |:..:.:|...|..|:..::| :|..|||..:  |:.|.:.|:|:.:|..:|..| |....|.|.
  Fly     1 MLYLLSVLIIVLISQEALSTD-YCNKDLCLPEITHIACRNYGDFDESCGSEAIIM-KFPMHMRAH 63

  Fly    64 IVDKHNEYRNKFAGGMDQNP---KAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAE 125
            ::...|::||..|.|  |.|   .|:||.|:.|..|||.:|...:|||:.|.|.|:.|..:.:..
  Fly    64 LLAVLNDFRNTVAKG--QYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVS 126

  Fly   126 VSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFF---SWTK----------NQQELSKN- 176
            ..|...|:.           ||:       ||.:..|.|   .|..          |.::.:|: 
  Fly   127 YIYGSTKWL-----------QLE-------KDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDG 173

  Fly   177 ----YF-QVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAA---- 232
                || |:::|.|..||||::  :|......|    |..|| ||......:..:....|:    
  Fly   174 QCRGYFTQLVQDLAAHVGCAMM--LRKGQTSGL----YQYGV-LCHFSRGKIANELVYRASAHPG 231

  Fly   233 SECMKGSNKQYKNLCHKDELV 253
            |.|..|::..|:.||..:|.|
  Fly   232 SRCYAGTHSIYEGLCSPEEHV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 46/170 (27%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 51/179 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440707
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.