DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crisp2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:200 Identity:39/200 - (19%)
Similarity:67/200 - (33%) Gaps:33/200 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRC---EPIRDQCAITPNYGHAE 125
            ||:||||.|...      ||..:.:..:||..:....|.....:|   ...:|...|....|   
Mouse    41 IVNKHNELRRSV------NPTGSDILKMEWSIQATTNAQKWANKCILEHSSKDDRKINIRCG--- 96

  Fly   126 VSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGC 190
                 |..: |:|........:..|::.|     :...:...........:|.|::...:.::||
Mouse    97 -----ENLY-MSTDPTLWSTVIQSWYNEN-----EDFVYGVGAKPNSAVGHYTQLVWYSSFKIGC 150

  Fly   191 AIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHK----DE 251
            .|.....    ...||..|.|  ..|...:|.:.:.|..:..:.|....|.....||..    ::
Mouse   151 GIAYCPN----QDNLKYFYVC--HYCPMGNNVMKKSTPYQQGTPCASCPNNCENGLCTNSCDFED 209

  Fly   252 LVKTC 256
            |:..|
Mouse   210 LLSNC 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 28/148 (19%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 30/155 (19%)
Crisp 189..243 CDD:285731 5/25 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841369
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.