DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and scl-12

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_504056.1 Gene:scl-12 / 186714 WormBaseID:WBGene00019178 Length:208 Species:Caenorhabditis elegans


Alignment Length:215 Identity:47/215 - (21%)
Similarity:77/215 - (35%) Gaps:64/215 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFA-GGMDQ----NPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH 123
            ||..||:.|:..| |..|.    .|.||.|..|:||..:|..|......|          |: .|
 Worm    26 IVKAHNDLRSAIALGNYDAAGTIEPPAANMRKIKWDSTVASSAQQYANTC----------PD-DH 79

  Fly   124 AEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFF------SWTKNQQE-------LSK 175
            :...|....|:..::..            |.|.|:     |      ||.|..|:       :..
 Worm    80 SGTEYGENLYWSWSSSA------------PTSLDK-----FGVAASNSWEKEFQDYGWESTYMDA 127

  Fly   176 NYF--------QVLRDRANRVGCAIVEYVRPALVHQLLK----CVYNCGVSLCEEEDNPVYEDTD 228
            :.|        |:.....|::||.:....:.:.::.:.|    |.|:...::.   |:.:|:..|
 Worm   128 DLFDSGIGHATQMAWAETNKIGCGVKNCGKDSSMNNMYKVAVVCQYDQAGNMM---DSDIYQSGD 189

  Fly   229 EEAASECMKGSN-KQYKNLC 247
              ..|.|..||. ::...||
 Worm   190 --TCSFCPSGSKCEEASGLC 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/175 (21%)
scl-12NP_504056.1 SCP 21..175 CDD:214553 38/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.