DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and C07A4.3

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_509707.2 Gene:C07A4.3 / 182352 WormBaseID:WBGene00007398 Length:207 Species:Caenorhabditis elegans


Alignment Length:182 Identity:40/182 - (21%)
Similarity:67/182 - (36%) Gaps:48/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DMIALIVDKHNEYR---NKFAGGMDQNPKAARMTTI--EWDPELAKVADGLVRRCEPIRDQCAI- 117
            |:...||..||:||   :..|..:|.|     :|.:  :|..|:|            ...:|.: 
 Worm    43 DLKKWIVHFHNKYRAHHSSPAVTVDSN-----LTNLAQKWSDEMA------------FHKKCLVH 90

  Fly   118 --TPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTK-NQQELSK--NY 177
              ...||....|::..|:....|...|    |.|.|      ..:...|::|: |....||  ::
 Worm    91 EQPSKYGENLTSFASSKFPSPKTCAAA----LIHGF------YTEGYGFNYTRFNPGSWSKVGHF 145

  Fly   178 FQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDE 229
            .|:|...:.::|..:....|..:.|          |.:|.:.|.|....|.|
 Worm   146 TQLLWKNSRKIGVGVSVAKRGTMYH----------VYVCIKYDPPGNMQTSE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 33/159 (21%)
C07A4.3NP_509707.2 CAP_GAPR1-like 43..183 CDD:349401 38/176 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.