powered by:
Protein Alignment CG10651 and C07A4.2
DIOPT Version :9
Sequence 1: | NP_001286095.1 |
Gene: | CG10651 / 35303 |
FlyBaseID: | FBgn0032853 |
Length: | 316 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_509706.2 |
Gene: | C07A4.2 / 182351 |
WormBaseID: | WBGene00007397 |
Length: | 417 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 27/65 - (41%) |
Gaps: | 9/65 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 TKKEALRKQLDHWFDPNSKDEVQKL--FFSWTKNQQELSKNYFQVLRD----RANRVGCAIVEYV 196
|.|.|:.| .||.:...:|..... |||...||::.......|..| |.:.:| ||..|:
Worm 172 TSKTAIEK--THWSNTILRDSRGGALDFFSRLTNQKKYDLKSASVPLDTDVKRLSNIG-AIKSYL 233
Fly 197 196
Worm 234 233
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG10651 | NP_001286095.1 |
SCP_euk |
61..210 |
CDD:240180 |
19/65 (29%) |
C07A4.2 | NP_509706.2 |
CAP_GAPR1-like |
251..402 |
CDD:349401 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.