DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and vap-1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001024553.1 Gene:vap-1 / 181768 WormBaseID:WBGene00006886 Length:424 Species:Caenorhabditis elegans


Alignment Length:236 Identity:55/236 - (23%)
Similarity:89/236 - (37%) Gaps:67/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 CPKQAAAM------VKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMT------TIEWDPEL- 97
            |.::|.|.      .|::.....:..|.||:.|...|.|::.| |...::      .:.||.|: 
 Worm    12 CLERAVAQTFGCSNTKINDQARKMFYDAHNDARRSMAKGLEPN-KCGLLSGGKNVYELNWDCEME 75

  Fly    98 AKV---ADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFCMTTKKEAL---RKQLDHWF----- 151
            ||.   |||    | |...| ...|.:|....:|       |.:..:.|   ...::.|:     
 Worm    76 AKAQEWADG----C-PSSFQ-TFDPTWGQNYATY-------MGSIADPLPYASMAVNGWWSEIRT 127

  Fly   152 ----DPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLL--KCVYN 210
                ||::|.....:|            .:..:...:|:..|||.      ||....|  .|:||
 Worm   128 VGLTDPDNKYTNSAMF------------RFANMANGKASAFGCAY------ALCAGKLSINCIYN 174

  Fly   211 CGVSLCEEEDNPVYEDTDE-EAASECMKGSNKQYKN-LCHK 249
               .:....:..:||..|. .:.:||...|:.|.|| ||:|
 Worm   175 ---KIGYMTNAIIYEKGDACTSDAECTTYSDSQCKNGLCYK 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 37/172 (22%)
vap-1NP_001024553.1 SCP 31..175 CDD:214553 39/178 (22%)
SCP 234..386 CDD:214553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.