DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and lon-1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_498166.1 Gene:lon-1 / 175753 WormBaseID:WBGene00003055 Length:312 Species:Caenorhabditis elegans


Alignment Length:275 Identity:56/275 - (20%)
Similarity:81/275 - (29%) Gaps:97/275 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
            |..:||.||...        .|:.|..:.|..|||..|       :...|.|....:.|...|..
 Worm    84 ITHEHNRYRRMV--------PASDMNMLYWSDELAASA-------QRHADTCDFRHSRGRINVGE 133

  Fly   129 SLEKYFCMTTKKEALRKQLDHWFDP--NSKDEVQKLFFSWTKN--------QQELSKNYFQVLRD 183
            ::                   |..|  |..|.: .::|:...|        .:....:|.||:..
 Worm   134 NI-------------------WAAPYSNYSDAI-SIWFNEVHNPRCGCNHAYKHCCGHYVQVVWA 178

  Fly   184 RANRVGCAI-----VEYVRPALVHQLLKCVYNCGVSLCEEEDNPVY---------------EDTD 228
            :.|.|||..     |:.|.......:..|.||       .:.|.|:               ...|
 Worm   179 KTNLVGCGFSRCRDVQGVWGRGHRNVFVCHYN-------PQGNTVFVTARGQLYAMPAFTWASGD 236

  Fly   229 EEAASECMKGSNKQYKNLCH--------------------KDELVKTCNGGSLFVEPENDYND-G 272
            ....|.|...:...|:.||:                    .:|...||...    |||.:..| .
 Worm   237 NGKCSNCPANAPACYQGLCYMPKNYEAPTTTTESTTTSTTTEEPTTTCEPD----EPEAEGADNN 297

  Fly   273 QEENMENDYEFETTV 287
            |||..||:..|...|
 Worm   298 QEEEEENNDGFRMRV 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 32/160 (20%)
lon-1NP_498166.1 SCP 81..211 CDD:214553 34/168 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.