DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG43777

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:323 Identity:68/323 - (21%)
Similarity:113/323 - (34%) Gaps:104/323 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IW-LLFSTLYIQDTGASDKWC-----KADLCRGQHVLC--------DDNGNFESTCPKQAAAMVK 55
            :| ||.:.:.:....:...:|     |..|.:.:|.:|        .::..|.::.|.. ..|.|
  Fly     2 MWRLLLAVVLLLPLTSGYNYCNNKTHKCVLEKKKHFMCHLKDFTVYGNSTKFHASVPNN-MRMQK 65

  Fly    56 MSWDMIALIVDKHNEYRNKFAGGMDQN------PKAARMTTIEWDPELAKVADGLVRRCEPIRDQ 114
            ::.|::       |..|||||||..:.      .||.||..:.||.|||.:.:...........|
  Fly    66 IALDIL-------NNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSLKSSQ 123

  Fly   115 CAITPNYGHAEVSYSLEKYFCMTTKKEALR-------------KQLDHWFDPNSKDEVQKLFFSW 166
            |..|..:.|...:.:|      .|.:|.|.             .:..|..||::      |..::
  Fly   124 CRSTLRFPHVGEAIAL------VTPREKLNLKEIYSKAFTPMFAEYQHVSDPDA------LLHAF 176

  Fly   167 TKNQQELSKNYFQVLRDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSL-------CEEEDNPVY 224
            ..::....:::..::.||.:||||.:....             ||..|:       |       |
  Fly   177 DPDRDFQVRHFTNIISDRVSRVGCGVAVGA-------------NCNPSIKFCHFLTC-------Y 221

  Fly   225 EDTDEEAASECMKG-------------SNKQYKNLCHKDELVKTCNGGSLFVEPENDYNDGQE 274
            .|....|.|...|.             |:.:|.|||.        |.|.:|   .:|:.|..|
  Fly   222 FDFHNMAGSYVYKAGDPTSSCDDWGVVSSDKYANLCK--------NSGEIF---PHDHGDRVE 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 35/167 (21%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 42/197 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440517
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.