DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG43776

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster


Alignment Length:283 Identity:62/283 - (21%)
Similarity:107/283 - (37%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLFSTLYIQDTGASDKWCKADLCRGQHVLCD-------DNGNFESTCPKQAAAMVKMSWDMIALI 64
            |:.||:.......:::..:..|...||.:|.       ....:.:..|.    :.|:..:::.:|
  Fly    11 LMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIVPD----IPKLRTEILRII 71

  Fly    65 VDKHNEYRNKFAGG---MDQN---PKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAIT---PN 120
                |.:||:||.|   ..:|   .:|.||..|.||.|||.:|............:|..|   |.
  Fly    72 ----NNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPR 132

  Fly   121 YGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSK-DEVQKLFFSWTKNQQELSKNYFQVLRDR 184
            .|.. ::..:.||  ..|..|||:|.....||.:.. .:.:.|...:...:..:|.::..::.||
  Fly   133 VGEC-LAMMVPKY--KHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDR 194

  Fly   185 ANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCE--------EEDNPVYEDTDEEAASECM---KG 238
            .:||||.:....         .|......:.|.        :..|..|.....:.||.|.   ..
  Fly   195 VSRVGCGVAVGT---------NCRQGSSSNFCHFLTCYFDYDNVNGSYVYKAGKPASSCSDWGTT 250

  Fly   239 SNKQYKNLCHKDELVKTCNGGSL 261
            .:|::.|||:        |.|:|
  Fly   251 KSKEFANLCY--------NNGNL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 40/158 (25%)
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 41/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.