DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and GLIPR1L2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001257325.1 Gene:GLIPR1L2 / 144321 HGNCID:28592 Length:344 Species:Homo sapiens


Alignment Length:176 Identity:36/176 - (20%)
Similarity:65/176 - (36%) Gaps:34/176 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH 123
            |.|...|:.|||.|.      |..|:.:.:..:.||..|::.|....::       |..|.|...
Human    52 DFINEYVNLHNELRG------DVIPRGSNLRFMTWDVALSRTARAWGKK-------CLFTHNIYL 103

  Fly   124 AEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELS----------KNYF 178
            .:|.....|::.:..         :.|..|.::........||...::..:          .||.
Human   104 QDVQMVHPKFYGIGE---------NMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYI 159

  Fly   179 QVLRDRANRVGCAIVEYVRPA-LVH-QLLKCVYNCGVSLCEEEDNP 222
            |::.|.:.:||||:....:.. ::| .:..|.|..|.:|......|
Human   160 QLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEP 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 31/160 (19%)
GLIPR1L2NP_001257325.1 SCP_GLIPR-1_like 52..195 CDD:240185 33/164 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 292..344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.