Sequence 1: | NP_001286095.1 | Gene: | CG10651 / 35303 | FlyBaseID: | FBgn0032853 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033769.1 | Gene: | Crisp3 / 11572 | MGIID: | 102552 | Length: | 241 | Species: | Mus musculus |
Alignment Length: | 262 | Identity: | 52/262 - (19%) |
---|---|---|---|
Similarity: | 86/262 - (32%) | Gaps: | 84/262 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 LCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAK 99
Fly 100 VADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFC-----MTTKKEALRKQLDHWFDPNSKDEV 159
Fly 160 QKLFFS-----------------WTKNQQ------ELSKN---YFQVLRDRANRVGCAIVEY--- 195
Fly 196 --VRPALVH----QLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVK 254
Fly 255 TC 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10651 | NP_001286095.1 | SCP_euk | 61..210 | CDD:240180 | 36/188 (19%) |
Crisp3 | NP_033769.1 | SCP | 37..172 | CDD:294090 | 30/166 (18%) |
Crisp | 194..241 | CDD:285731 | 12/53 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C167841474 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |