DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crisp3

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_033769.1 Gene:Crisp3 / 11572 MGIID:102552 Length:241 Species:Mus musculus


Alignment Length:262 Identity:52/262 - (19%)
Similarity:86/262 - (32%) Gaps:84/262 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LCDDNGNFESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAK 99
            |..||.. |::..|.:.:...:..:    ||.|||:.|.|.      :|..:.:..:||:.: |:
Mouse    18 LLQDNSQ-ENSLEKLSTSKKSVQEE----IVSKHNQLRRKV------SPSGSDLLNMEWNYD-AQ 70

  Fly   100 VADGLVRRCEPIRDQCAITPNYGHAEVSYSLEKYFC-----MTTKKEALRKQLDHWFDPNSKDEV 159
            |      ..:...|:|    .:.|:.:........|     |::........:..|:     :|.
Mouse    71 V------NAQQRADKC----TFSHSPIELRTTNLKCGENLFMSSYLVPWSSVIQGWY-----NES 120

  Fly   160 QKLFFS-----------------WTKNQQ------ELSKN---YFQVLRDRANRVGCAIVEY--- 195
            :.|.|.                 |..|.|      |..:|   ||.|.|      .|.::.|   
Mouse   121 KGLIFGVGPKQNVSVVGHHTQVVWKSNLQVACGVAECPENPLRYFYVCR------YCPVLNYSGH 179

  Fly   196 --VRPALVH----QLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVK 254
              .||.|.:    ....|...|...||.:...  |:|         |....|:.:.:|....|.|
Mouse   180 YPSRPYLAYTARAPCASCPDRCEDGLCTKSCQ--YKD---------MSFWCKRLEYVCKHPGLKK 233

  Fly   255 TC 256
            .|
Mouse   234 RC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 36/188 (19%)
Crisp3NP_033769.1 SCP 37..172 CDD:294090 30/166 (18%)
Crisp 194..241 CDD:285731 12/53 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841474
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.