DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and Crisp1

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:230 Identity:43/230 - (18%)
Similarity:79/230 - (34%) Gaps:71/230 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
            ||.|||:.|...      :|..:.:..:||:.: |:|      ..:...|:|    .:.|:.:..
Mouse    42 IVSKHNQLRRMV------SPSGSDLLKMEWNYD-AQV------NAQQWADKC----TFSHSPIEL 89

  Fly   129 SLEKYFC-----MTTKKEALRKQLDHWFDPNSKDEVQKLFFS-WTKNQQELSKNYFQVLRDRANR 187
            ......|     |::...:....:..|:     :|.:.|.:. ..|....:..:|.||:.:...:
Mouse    90 RTTNLRCGENLFMSSYLASWSSAIQGWY-----NEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQ 149

  Fly   188 VGCAIVEYVRPALVHQLL------------------------KCVYNCGVSLCEEEDNPVYEDTD 228
            |.|.:.|..:..|.:..:                        .|..:|...||.....  :||  
Mouse   150 VACGVAECPKNPLRYYYVCHYCPVGNYQGRLYTPYTAGEPCASCPDHCEDGLCTNSCG--HED-- 210

  Fly   229 EEAASECMKGSNKQY--KNLCHKDELVK-----TC 256
                    |.:|.:|  |.|..:.||:|     ||
Mouse   211 --------KYTNCKYLKKMLSCEHELLKKGCKATC 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 28/175 (16%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 27/151 (18%)
Crisp 190..244 CDD:285731 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841473
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.