DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and glipr1a

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017210734.1 Gene:glipr1a / 108179203 ZFINID:ZDB-GENE-110309-2 Length:269 Species:Danio rerio


Alignment Length:229 Identity:50/229 - (21%)
Similarity:80/229 - (34%) Gaps:65/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRC-----EPIRDQCAITPNYGHA 124
            |.:||:.|:..      :|.||.|..:.||..||..|....|.|     ..:|:...:.|.:   
Zfish    36 VREHNQNRSSV------SPTAANMRYMTWDAALAVTARAWARFCLFKHNIHLREAKRVHPTF--- 91

  Fly   125 EVSYSLEKYFCMTTKKEALRKQLDHWFD-PNSKDEVQKLFFSWTK------------NQQELSKN 176
                        ||..|.:      |.. |.|:..|:...|||..            |.:::..:
Zfish    92 ------------TTVGENI------WAGAPYSRFTVKSAVFSWVNELKDYNYNNNQCNDKKVCGH 138

  Fly   177 YFQVLRDRANRVGCAI---VEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASEC--M 236
            |.||:...:.:||||:   ...|.......:...::.|..:..   .|.......::.|| |  .
Zfish   139 YTQVVWADSYKVGCAVQTCPNGVAETHFSNIQGVIFVCNYATA---GNFAGRSPYKQGAS-CSGC 199

  Fly   237 KGSNKQYKNLCHKDELVKTCNGGSLFVEPENDYN 270
            .||:|..:|||...:.           :.|..||
Zfish   200 GGSDKCERNLCRNTDR-----------DAEQSYN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 36/165 (22%)
glipr1aXP_017210734.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.