DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CRISP3

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001355052.1 Gene:CRISP3 / 10321 HGNCID:16904 Length:276 Species:Homo sapiens


Alignment Length:227 Identity:53/227 - (23%)
Similarity:79/227 - (34%) Gaps:77/227 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
            ||:||||.|...      :|.|..|..:||:.|.|..|.....:|           ||.|:....
Human    73 IVNKHNELRRAV------SPPARNMLKMEWNKEAAANAQKWANQC-----------NYRHSNPKD 120

  Fly   129 SLEKYFC-----MTTKKEALRKQLDHWFD----------PNSKDEV-----QKLFFS-------- 165
            .:....|     |::...:..:.:..|||          |.:.:.|     |.:::|        
Human   121 RMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGN 185

  Fly   166 -WTKNQQELSKNYFQVLR-----DRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVY 224
             :..||:.|  .|:.|.:     :.|||:   .|.|.:.|   ....|..||...||  .:...|
Human   186 AYCPNQKVL--KYYYVCQYCPAGNWANRL---YVPYEQGA---PCASCPDNCDDGLC--TNGCKY 240

  Fly   225 EDTDEEAASECMKGSNKQYKNLCHKDELVKTC 256
            ||.               |.| |...:|..||
Human   241 EDL---------------YSN-CKSLKLTLTC 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 40/179 (22%)
CRISP3NP_001355052.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151355
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.