Sequence 1: | NP_001286095.1 | Gene: | CG10651 / 35303 | FlyBaseID: | FBgn0032853 | Length: | 316 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001355052.1 | Gene: | CRISP3 / 10321 | HGNCID: | 16904 | Length: | 276 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 53/227 - (23%) |
---|---|---|---|
Similarity: | 79/227 - (34%) | Gaps: | 77/227 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSY 128
Fly 129 SLEKYFC-----MTTKKEALRKQLDHWFD----------PNSKDEV-----QKLFFS-------- 165
Fly 166 -WTKNQQELSKNYFQVLR-----DRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVY 224
Fly 225 EDTDEEAASECMKGSNKQYKNLCHKDELVKTC 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10651 | NP_001286095.1 | SCP_euk | 61..210 | CDD:240180 | 40/179 (22%) |
CRISP3 | NP_001355052.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165151355 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 49 | 1.000 | Inparanoid score | I5480 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.800 |