DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and LOC101883528

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_005162473.1 Gene:LOC101883528 / 101883528 -ID:- Length:261 Species:Danio rerio


Alignment Length:244 Identity:56/244 - (22%)
Similarity:95/244 - (38%) Gaps:57/244 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 AMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCA 116
            |:.:::...|..|||.|||.|::.      .|.||.|..:.||..:..||:|...:|  |.|.  
Zfish    19 AVGQLTEQEILNIVDLHNELRSQV------QPSAAFMQKVVWDETIRLVAEGYAAKC--IWDH-- 73

  Fly   117 ITPNYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKN---QQELSKNYF 178
             .|:..|..:.   |..|..|....|.:..:| ||:.|       |.:::..|   :.::..:|.
Zfish    74 -NPDLEHLTMG---ENLFVGTGPFNATKAVMD-WFNEN-------LDYNYNTNDCAEDKMCGHYT 126

  Fly   179 QVLRDRANRVGCA------------------IVEYVRPALV---------HQLLKCVYNCGVSLC 216
            |::.....::|||                  |.:|.....:         ....||...|..::|
Zfish   127 QLVWANTTKIGCASYFCDTLEKLHFEKATLLICDYYPQGNIEGQKPYESGESCSKCPEECENNIC 191

  Fly   217 EEED-NPVYEDTDEEAASECMKGSNKQ----YKNLCHKDELVKTCNGGS 260
            ..|: .|.:||||.::.....:...::    |.....:|.|.|..:.||
Zfish   192 VMENLFPPFEDTDPKSTQMSTEPKVQEPTVVYVETKERDMLTKIISQGS 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 41/178 (23%)
LOC101883528XP_005162473.1 SCP_HrTT-1 28..162 CDD:240186 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.