DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and CG42764

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001189140.1 Gene:CG42764 / 10178963 FlyBaseID:FBgn0261832 Length:232 Species:Drosophila melanogaster


Alignment Length:194 Identity:38/194 - (19%)
Similarity:63/194 - (32%) Gaps:59/194 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 EVSYSLEKY-------------FCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKN 176
            |:|:..|:|             ...|.|...:|  :||...|.|:.|..    .:|:|       
  Fly    44 ELSHDAEEYAIHLATLNIPDQILYETAKDRNIR--VDHLDYPLSEPEND----FYTEN------- 95

  Fly   177 YFQVLRDRANRVGCAIVEYVRPALVHQLLKCVY------NCGVSLCEEEDNPVYEDTDEEAASEC 235
                           |.|::|.       :|||      .....:.:|....|.:...::.::..
  Fly    96 ---------------ICEFIRN-------ECVYYWASEGAASYGIAKERRTKVEQSLADKFSAIT 138

  Fly   236 MKGSNKQYKNLCHKDELVKTCNGGSLFVEPENDYNDGQEENMEN--DYEFETTVFTLPTYDPND 297
            .|.:.:.......||...|  .|..:.|...:...:...|..||  |.|| ...|.:||.:..|
  Fly   139 WKSTTEMGVGWAPKDRSKK--GGRKILVVRYSPAGNQPGEYAENIGDTEF-LEYFKMPTREDPD 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 20/103 (19%)
CG42764NP_001189140.1 SCP 22..172 CDD:294090 28/164 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.