DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and LOC100536500

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:178 Identity:38/178 - (21%)
Similarity:59/178 - (33%) Gaps:47/178 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVS- 127
            |||.||.:|...      .|.|:.|..:.|...:|:.|.|.:.:|           |..|...| 
Zfish    43 IVDVHNAFRRAV------QPSASNMLKMSWSDAVAESARGWINKC-----------NMTHGPPSS 90

  Fly   128 -----YSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANR 187
                 |.:.:.....|...:....:|.|     ..||....:.......:.:.:|.||:...:..
Zfish    91 RMLNGYEMGENLFKATGISSWTSVVDAW-----HSEVNNYKYPIGSINGQATGHYTQVVWYSSYE 150

  Fly   188 VGCAIVE----------YVRP---------ALVHQLLKCVYNCGVSLC 216
            ||||:.:          |.|.         :|......|..||..:||
Zfish   151 VGCAVTQCGSNYFYGCHYYRAGNFRTVPPYSLGSPCASCPNNCEDNLC 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 34/170 (20%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585641
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.