DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and crispld2

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:162 Identity:33/162 - (20%)
Similarity:58/162 - (35%) Gaps:46/162 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 MSWDMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPN 120
            :.|.....|:..||:.|.      :..|.|:.|..:.||.||.:.|.....:|:         ..
Zfish    56 IEWSDREEILKLHNKLRG------EVYPTASNMEYMIWDDELERSATSWAEQCQ---------WE 105

  Fly   121 YGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSK--------DEVQKLFF-------SWTKNQ 170
            :|..::..|:.:...:            ||....|.        |||:...:       .|...:
Zfish   106 HGPQDLLMSIGQNLAV------------HWGRYRSPAYHVQAWYDEVKDYTYPYPHECNPWCPER 158

  Fly   171 --QELSKNYFQVLRDRANRVGCAIVEYVRPAL 200
              ..:..:|.|::....||||||:  :|.|.:
Zfish   159 CSGPMCTHYTQLVWATTNRVGCAV--HVCPRM 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 32/157 (20%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 32/157 (20%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585824
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.