DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and crisp2-like

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001188271.2 Gene:crisp2-like / 100495843 -ID:- Length:207 Species:Xenopus tropicalis


Alignment Length:272 Identity:48/272 - (17%)
Similarity:79/272 - (29%) Gaps:94/272 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKCIWLLFSTLYIQDTGASDKWCKADLCRGQHVLCDDNGNFESTCPKQAAAMVKMSWDMIALIVD 66
            |.||..||.:.|..|.|..             :|..:..|:                     :||
 Frog    10 IICISALFHSTYGDDGGTP-------------MLDTETQNY---------------------LVD 40

  Fly    67 KHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVSYSLE 131
            .||..|...      :|.|..|..:||.|..|..|.....:|  :....:.|........:|...
 Frog    41 LHNLLRRSV------DPTAKDMLKMEWSPGAALNAQNAAAKC--VMQHSSATERQIQDPFNYVCG 97

  Fly   132 KYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVLRDRANRVGCAIVEYV 196
            :...:||.|......::.||     :|.....:....|..::..:|.||...:...:|       
 Frog    98 ENIYVTTAKPDWAAAVNSWF-----NERNDFTYGVGPNSDKMIGHYTQVAWAKTYLLG------- 150

  Fly   197 RPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNLCHKDELVKTCNGGSL 261
                          ||::.|                    .|:...|.::||      .|..|::
 Frog   151 --------------CGLAFC--------------------PGNYYPYVSICH------YCPMGNM 175

  Fly   262 FVEPENDYNDGQ 273
            ....:..|..|:
 Frog   176 INSIKTPYEAGE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 27/148 (18%)
crisp2-likeNP_001188271.2 SCP 33..171 CDD:320774 35/218 (16%)
Crisp 189..>205 CDD:312162
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.