DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and r3hdml

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017953344.1 Gene:r3hdml / 100492715 XenbaseID:XB-GENE-1011048 Length:253 Species:Xenopus tropicalis


Alignment Length:184 Identity:41/184 - (22%)
Similarity:70/184 - (38%) Gaps:44/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LCRGQHVLCDDNGN-----FESTCPKQAAAMVKMSWDMIALIVDKHNEYRNKFAGGMDQNPKAAR 87
            |.|...:|...|.|     |.|..|:..........||.||: |.||:.|:|..      |.||.
 Frog    26 LDRATELLSLSNRNQTEHMFGSGIPRIRRKRYISPRDMSALL-DYHNQVRSKVF------PPAAN 83

  Fly    88 MTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAE---VSYSLEKYFCMTTKKEALRKQLDH 149
            |..:.||..|||.|:....:|:           :.|..   :.|..:.....:.:..::...:..
 Frog    84 MEYMVWDERLAKSAESWANQCK-----------WDHGPNQLMRYIGQNLSVHSGRYRSIVDLVKG 137

  Fly   150 WFDPNSKDEVQKLFFSW-----------TKNQQELSKNYFQVLRDRANRVGCAI 192
            |:|       ::..:|:           .|....:..:|.|::...:||:|||:
 Frog   138 WYD-------ERQHYSFPHPRECNPSCPNKCTGAVCTHYTQMVWASSNRIGCAV 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 31/146 (21%)
r3hdmlXP_017953344.1 CAP_R3HDML 63..208 CDD:349409 32/147 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5157
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.