DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10651 and pi15

DIOPT Version :9

Sequence 1:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_002937120.1 Gene:pi15 / 100489915 XenbaseID:XB-GENE-989406 Length:258 Species:Xenopus tropicalis


Alignment Length:151 Identity:43/151 - (28%)
Similarity:64/151 - (42%) Gaps:45/151 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 DMIALIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGH 123
            |||| ||:.||:.|.|..      |.||.|..:.||..|||:|:.....|  |.|.   .|:|  
 Frog    66 DMIA-IVEYHNQVRGKVF------PPAANMEYMVWDENLAKLAEAWAATC--IWDH---GPSY-- 116

  Fly   124 AEVSYSLEKYF-----CMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQE----------- 172
                  |.|:.     ..|.:.:::.:.:..|:     |||:...|.:   .||           
 Frog   117 ------LLKFLGQNLSVRTGRYKSILQLVKPWY-----DEVKDYAFPY---PQECNPRCPLRCYG 167

  Fly   173 -LSKNYFQVLRDRANRVGCAI 192
             :..:|.|::....||:||||
 Frog   168 PMCTHYTQMVWATTNRIGCAI 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 41/149 (28%)
pi15XP_002937120.1 CAP_PI15 67..212 CDD:349408 42/150 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.