DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and AT1G62190

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_176410.1 Gene:AT1G62190 / 842515 AraportID:AT1G62190 Length:295 Species:Arabidopsis thaliana


Alignment Length:214 Identity:55/214 - (25%)
Similarity:93/214 - (43%) Gaps:34/214 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 HLRLERISVAFLSALCGIITADFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHD 171
            ||.|:    ..|:...|.:.||..||:.|||.|.:|....|::|.. |...:.||..|.:||:..
plant    95 HLWLQ----PALACYAGYVFADLGSGVYHWAIDNYGGASTPIVGAQ-LEASQGHHKYPWTITKRQ 154

  Fly   172 FIETN-----GDNFMV---GIPILGYLAHYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKW 228
            |...:     ...|:|   .:.|...|.|.|              ::....|   :.::.|.|.|
plant   155 FANNSYTIARAITFIVLPLNLAINNPLFHSF--------------VSTFAFC---ILLSQQFHAW 202

  Fly   229 SH-TYWGLPRWVLLLQSCHIILPRKHHRIHHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEH 292
            :| |...||..|:.||...:::.||.|..||.||:.:.:|:.:|..|..|:....:...|:.:..
plant   203 AHGTKSKLPPLVMALQDMGLLVSRKDHPGHHQAPYNSNYCVVSGAWNKVLDESNLFKALEMALFF 267

  Fly   293 FTGLKP---RDDDLKWAKK 308
            ..|::|   .:.:..|.::
plant   268 QFGVRPNSWNEPNSDWTEE 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 49/188 (26%)
AT1G62190NP_176410.1 TMEM189_B_dmain 108..276 CDD:287490 49/185 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2947
eggNOG 1 0.900 - - E1_KOG3011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2341
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003637
OrthoInspector 1 1.000 - - otm2799
orthoMCL 1 0.900 - - OOG6_104857
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.720

Return to query results.
Submit another query.