DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and FADA

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_194433.1 Gene:FADA / 828811 AraportID:AT4G27030 Length:323 Species:Arabidopsis thaliana


Alignment Length:328 Identity:87/328 - (26%)
Similarity:135/328 - (41%) Gaps:74/328 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAPATTKDKESVKPEELKVTPAGTKATSPP-------------------NSATLVSTSPRWGPQN 68
            |.|.|...| |.:|..|:|....:..|:.|                   |..:|.||.||  |..
plant    11 LRPITNIPK-SHRPSLLRVRVTCSVTTTKPQPNREKLLVEQRTVNLPLSNDQSLQSTKPR--PNR 72

  Fly    69 KG---AQELA---LLYSPGKRAQEIICVYTCIG--LMIINLALIV-----RHLRLERISVAFLSA 120
            :.   .|.||   |...|..::.....::...|  .:.::||..|     .||.||    ..|:.
plant    73 EKLVVEQRLASPPLSNDPTLKSTWTHRLWVAAGCTTLFVSLAKSVIGGFDSHLCLE----PALAG 133

  Fly   121 LCGIITADFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDN------ 179
            ..|.|.||..||:.|||.|.:|....|::|.. :..|:.||..|.:|||..|    .:|      
plant   134 YAGYILADLGSGVYHWAIDNYGDESTPVVGTQ-IEAFQGHHKWPWTITRRQF----ANNLHALAQ 193

  Fly   180 ---FMVGIPI-LGYLAHYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSH-TYWGLPRWV 239
               |.| :|: |.:....|:           |::.....|.:|   :.|.|.|:| |...||..|
plant   194 VITFTV-LPLDLAFNDPVFH-----------GFVCTFAFCILF---SQQFHAWAHGTKSKLPPLV 243

  Fly   240 LLLQSCHIILPRKHHRIHHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLKPRDDDLK 304
            :.||...:::.|:.|..||.||:...:||.:|..|..|:..:.:...|::.....|::||    .
plant   244 VALQDMGLLVSRRQHAEHHRAPYNNNYCIVSGAWNNVLDESKVFEALEMVFYFQLGVRPR----S 304

  Fly   305 WAK 307
            |::
plant   305 WSE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 54/187 (29%)
FADANP_194433.1 TMEM189_B_dmain 137..305 CDD:402241 54/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2947
eggNOG 1 0.900 - - E1_KOG3011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1421561at2759
OrthoFinder 1 1.000 - - FOG0003637
OrthoInspector 1 1.000 - - otm2799
orthoMCL 1 0.900 - - OOG6_104857
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.