DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and AT2G22890

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_179874.1 Gene:AT2G22890 / 816820 AraportID:AT2G22890 Length:279 Species:Arabidopsis thaliana


Alignment Length:308 Identity:77/308 - (25%)
Similarity:124/308 - (40%) Gaps:66/308 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LAPATTKDKESVKPEELKVTPAGT-------------KATSPP--NSATLVSTSPRWGPQNKGAQ 72
            |.|.|.....|.:|..|:||....             :..:||  |..||.||   |..:     
plant    11 LNPITNNIPRSHRPSFLRVTSTTNSQPNHEMKLVVEQRLVNPPLSNDPTLQST---WTHR----- 67

  Fly    73 ELALLYSPGKRAQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITADFASGLVHWA 137
               |..:.|       |....:......:.....||.||    ..|:...|.|.||..||:.|||
plant    68 ---LWVAAG-------CTTVFVSFSKSIIGAFGSHLWLE----PSLAGFAGYILADLGSGVYHWA 118

  Fly   138 ADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFM------VGIPI-LGYLAHYFY 195
            .|.:|....|::|.: :...::||..|.:||:..|  .|..:||      :.:|: |.:..|..:
plant   119 TDNYGDESTPLVGIH-IEDSQDHHKCPWTITKRQF--ANNLHFMARGTTLIVLPLDLAFDDHVVH 180

  Fly   196 IRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSH-TYWGLPRWVLLLQSCHIILPRKHHRIHHV 259
                       |:::....|.:|..:   .|.|:| |...||..|:.||...:::.|.||..||.
plant   181 -----------GFVSMFAFCVLFCQL---FHAWAHGTKSKLPPLVVGLQDIGLLVSRIHHMNHHR 231

  Fly   260 APHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLKPRDDDLKWAK 307
            ||:...:|:.:|..|..|:....:...|:::....|::||    .|.:
plant   232 APYNNNYCVVSGVWNKVLDESNVFKAMEMVLYIQLGVRPR----SWTE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 51/184 (28%)
AT2G22890NP_179874.1 TMEM189_B_dmain 105..273 CDD:402241 51/188 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2947
eggNOG 1 0.900 - - E1_KOG3011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I2341
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1421561at2759
OrthoFinder 1 1.000 - - FOG0003637
OrthoInspector 1 1.000 - - otm2799
orthoMCL 1 0.900 - - OOG6_104857
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.730

Return to query results.
Submit another query.