DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and PEDS1-UBE2V1

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_954673.2 Gene:PEDS1-UBE2V1 / 387522 HGNCID:33521 Length:370 Species:Homo sapiens


Alignment Length:245 Identity:133/245 - (54%)
Similarity:165/245 - (67%) Gaps:11/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RWGPQNKGAQELALLYSPGKRAQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITA 127
            |||.|:.||:|||.|||||||.||...|..|..|:..||..::...|.|...:..|..:.|.:.|
Human    23 RWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNLVHLLLLARWEDTPLVILGVVAGALIA 87

  Fly   128 DFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFMVG-IPILGYLA 191
            ||.||||||.|||||||::|::||.|:|||||||:|||:|||||||||||||.:|. :|:|. :|
Human    88 DFLSGLVHWGADTWGSVELPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLN-MA 151

  Fly   192 HYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVLLLQSCHIILPRKHHRI 256
            :.|...:|..::|.:.|..:||...||...|||||||||||:||||||.|||..|:|||||||||
Human   152 YKFRTHSPEALEQLYPWECFVFCLIIFGTFTNQIHKWSHTYFGLPRWVTLLQDWHVILPRKHHRI 216

  Fly   257 HHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLK-PRDDDLKW 305
            |||:|||||||||||        ::....|.|:.|...|.| ..|..:.|
Human   217 HHVSPHETYFCITTG--------VKVPRNFRLLEELEEGQKGVGDGTVSW 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 104/178 (58%)
PEDS1-UBE2V1NP_954673.2 TMEM189_B_dmain 85..251 CDD:402241 104/174 (60%)
UBCc 239..365 CDD:214562 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 260 1.000 Domainoid score I1991
eggNOG 1 0.900 - - E1_KOG3011
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 321 1.000 Inparanoid score I2528
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56240
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003637
OrthoInspector 1 1.000 - - oto89802
orthoMCL 1 0.900 - - OOG6_104857
Panther 1 1.100 - - LDO PTHR48177
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4428
SonicParanoid 1 1.000 - - X4054
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1312.860

Return to query results.
Submit another query.