DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and Peds1

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001107224.1 Gene:Peds1 / 362278 RGDID:1309093 Length:271 Species:Rattus norvegicus


Alignment Length:248 Identity:147/248 - (59%)
Similarity:180/248 - (72%) Gaps:2/248 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RWGPQNKGAQELALLYSPGKRAQEIICVYTCIGLMIINLALIVRHLRLERISVAFLSALCGIITA 127
            |||.|:.||:|||.|||||||.||...|..|..|:..|...::...|.|...:..|..:.|.:.|
  Rat    24 RWGAQHAGARELAALYSPGKRLQEWCSVILCFSLIAHNSVHLLLLARWEHTPLVILGVVAGALVA 88

  Fly   128 DFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTSITRHDFIETNGDNFMVG-IPILGYLA 191
            ||.||||||.||||||||:|::||.|:|||||||:|||:|||||||||||||.:|. :|:|. :|
  Rat    89 DFLSGLVHWGADTWGSVDLPIVGKAFIRPFREHHIDPTAITRHDFIETNGDNCLVTLLPLLN-MA 152

  Fly   192 HYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHTYWGLPRWVLLLQSCHIILPRKHHRI 256
            :.|..::|..::|.:.|..:||...||...|||||||||||.|||.||.:||..|:|||||||||
  Rat   153 YKFQTQSPETLEQLYPWECFVFCLIIFGTFTNQIHKWSHTYLGLPCWVTVLQDWHVILPRKHHRI 217

  Fly   257 HHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGLKPRDDDLKWAKKL 309
            ||||||||||||||||||:|||.|.||...|.:|:..||.|||.||:|||:|:
  Rat   218 HHVAPHETYFCITTGWLNYPLEVIGFWRRLEDVIQSLTGEKPRADDMKWAQKI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 115/177 (65%)
Peds1NP_001107224.1 TMEM189_B_dmain 86..262 CDD:402241 115/176 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 258 1.000 Domainoid score I1938
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 290 1.000 Inparanoid score I2715
OMA 1 1.010 - - QHG56240
OrthoDB 1 1.010 - - D1421561at2759
OrthoFinder 1 1.000 - - FOG0003637
OrthoInspector 1 1.000 - - oto96914
orthoMCL 1 0.900 - - OOG6_104857
Panther 1 1.100 - - LDO PTHR48177
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4054
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.980

Return to query results.
Submit another query.