DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and CG40045

DIOPT Version :10

Sequence 1:NP_610026.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001036640.1 Gene:CG40045 / 3355079 FlyBaseID:FBgn0058045 Length:168 Species:Drosophila melanogaster


Alignment Length:76 Identity:24/76 - (31%)
Similarity:28/76 - (36%) Gaps:23/76 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FASGLV------HWAADTWGSVDIPMIGKNF-----------LRPFREHHLDPTSITRHDFIETN 176
            |::||:      .|.....|..|....|..|           |||.|...:  |.|. |..||.|
  Fly    25 FSAGLIDENDIFRWEVLIIGPPDTLYEGGFFKAHLYFPKEYPLRPPRMKFV--TEIW-HPNIEKN 86

  Fly   177 GDNFMVGIPIL 187
            ||   |.|.||
  Fly    87 GD---VCISIL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_610026.1 Lipid_desat 124..301 CDD:463132 24/76 (32%)
CG40045NP_001036640.1 UBCc_UBE2G1 5..159 CDD:467415 24/76 (32%)

Return to query results.
Submit another query.