powered by:
Protein Alignment Kua and ben
DIOPT Version :9
| Sequence 1: | NP_001188856.1 |
Gene: | Kua / 35300 |
FlyBaseID: | FBgn0032850 |
Length: | 310 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001162752.1 |
Gene: | ben / 32358 |
FlyBaseID: | FBgn0000173 |
Length: | 151 |
Species: | Drosophila melanogaster |
| Alignment Length: | 35 |
Identity: | 10/35 - (28%) |
| Similarity: | 14/35 - (40%) |
Gaps: | 3/35 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 45 GTKATSPPNSAT---LVSTSPRWGPQNKGAQELAL 76
|..|....|:|. ::.|.|...|...|..:|.|
Fly 22 GINAIPDENNARYFHVIVTGPNDSPFEGGVFKLEL 56
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Kua | NP_001188856.1 |
TMEM189_B_dmain |
124..301 |
CDD:287490 |
|
| ben | NP_001162752.1 |
UBCc |
3..149 |
CDD:412187 |
10/35 (29%) |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
1 |
0.930 |
- |
- |
|
C45438107 |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.
