DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Kua and peds1

DIOPT Version :9

Sequence 1:NP_001188856.1 Gene:Kua / 35300 FlyBaseID:FBgn0032850 Length:310 Species:Drosophila melanogaster
Sequence 2:NP_001192034.1 Gene:peds1 / 100551495 XenbaseID:XB-GENE-5858239 Length:289 Species:Xenopus tropicalis


Alignment Length:273 Identity:160/273 - (58%)
Similarity:192/273 - (70%) Gaps:5/273 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EELKVTPAGTKATSPPNSATLVSTSPRWGPQNKGAQELALLYSPGKRAQEIICVYTCIGLMIINL 101
            |.:.|...|...|.|....     |||||||:.||:|||.|||.|||.||.|||..|..|:..|.
 Frog    21 EGVSVERCGEGKTDPCKEG-----SPRWGPQHAGARELAELYSSGKRFQEWICVILCFILLSFNF 80

  Fly   102 ALIVRHLRLERISVAFLSALCGIITADFASGLVHWAADTWGSVDIPMIGKNFLRPFREHHLDPTS 166
            ..::|:...|..:..|:|...||||||||||||||.||||||||:|::||.|:|||||||:|||:
 Frog    81 VCLIRYFSFEHTASIFVSIFAGIITADFASGLVHWGADTWGSVDLPIVGKAFIRPFREHHIDPTA 145

  Fly   167 ITRHDFIETNGDNFMVGIPILGYLAHYFYIRTPSEIQQHFGWIAYVFLCSIFVAMTNQIHKWSHT 231
            |||||||||||||.|..:..|..:|:.|...||..|.:.:....::|..::||.:||||||||||
 Frog   146 ITRHDFIETNGDNCMATLIPLACMAYKFLFYTPDLIYKTYQLECFIFALAMFVTLTNQIHKWSHT 210

  Fly   232 YWGLPRWVLLLQSCHIILPRKHHRIHHVAPHETYFCITTGWLNWPLERIRFWSTFELIIEHFTGL 296
            |:|||.||:.||..||||||||||||||:||||||||||||||:|||.|.||...|..|:..||.
 Frog   211 YFGLPVWVVFLQDWHIILPRKHHRIHHVSPHETYFCITTGWLNYPLEMIGFWRRLEDFIQGVTGE 275

  Fly   297 KPRDDDLKWAKKL 309
            |||.||||||:|:
 Frog   276 KPRSDDLKWAQKV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KuaNP_001188856.1 TMEM189_B_dmain 124..301 CDD:287490 117/176 (66%)
peds1NP_001192034.1 TMEM189_B_dmain 103..280 CDD:371110 117/176 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 262 1.000 Domainoid score I1914
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 337 1.000 Inparanoid score I2343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1421561at2759
OrthoFinder 1 1.000 - - FOG0003637
OrthoInspector 1 1.000 - - oto103609
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4428
SonicParanoid 1 1.000 - - X4054
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.