DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18B and mRpS18C

DIOPT Version :10

Sequence 1:NP_523606.1 Gene:mRpS18B / 35299 FlyBaseID:FBgn0032849 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_524593.1 Gene:mRpS18C / 43609 FlyBaseID:FBgn0039765 Length:140 Species:Drosophila melanogaster


Alignment Length:129 Identity:28/129 - (21%)
Similarity:49/129 - (37%) Gaps:48/129 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 SAPDPKDRSKPIPVETSIRYLKSAAYKQTYGEDFVWTQYRRNHKGMYAPRKTRKTCIRQNRISTG 120
            :||:..|...||.:            |..|.:|               |::              
  Fly    32 AAPESSDLDLPIDI------------KNPYEKD---------------PQQ-------------- 55

  Fly   121 NPCPICRDEYLVLDYRNTELLEQFISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARD----SGY 180
              |.:|:.. :...|:|.:||.||.||::|.:.....||||::...::..|:.:|:.    .||
  Fly    56 --CILCKHS-IEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQVEQAILRAQQCLLMPGY 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18BNP_523606.1 Ribosomal_S18 131..181 CDD:460054 17/54 (31%)
mRpS18CNP_524593.1 Ribosomal_S18 63..113 CDD:460054 15/49 (31%)

Return to query results.
Submit another query.