DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS18B and mRpS18C

DIOPT Version :10

Sequence 1:NP_523606.1 Gene:mRpS18B / 35299 FlyBaseID:FBgn0032849 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_314899.4 Gene:mRpS18C / 1275632 VectorBaseID:AGAMI1_003321 Length:149 Species:Anopheles gambiae


Alignment Length:106 Identity:31/106 - (29%)
Similarity:51/106 - (48%) Gaps:20/106 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 NHKGMYAPRKTRK-------TCIRQNR----ISTGNP-------CPICRDEYLVLDYRNTELLEQ 143
            |...:.||..||.       |....|.    :...||       |.:|: ..:..||:|.:||.|
Mosquito    21 NKGALVAPTATRSAAPYKHYTTSADNNDSPVVLKDNPFAKERVQCVLCK-HGIDPDYKNVQLLSQ 84

  Fly   144 FISPHSGDVLSYSKTGLCQKSHLRLMVAVQQARDSGYL-TY 183
            |.||::|.|...:.||||:..|.::...:.:|:::|:: ||
Mosquito    85 FQSPYTGRVYGRNITGLCKNRHEQVEREIIKAQNAGFMPTY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS18BNP_523606.1 Ribosomal_S18 131..181 CDD:460054 18/49 (37%)
mRpS18CXP_314899.4 None

Return to query results.
Submit another query.